PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00056.60
Common NameAMTR_s00056p00085520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 842aa    MW: 92378.8 Da    PI: 6.3481
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00056.60genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-181775357
                                             --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                                 Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                             k  ++t+eq+e+Le+l++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  evm_27.model.AmTr_v1.0_scaffold00056.60 17 KYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 75
                                             5679*****************************************************97 PP

2START172.92e-541613692205
                                              HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGC CS
                                    START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeq 71 
                                              +aee+++e+++ka+ ++  W +++ +++g++++ +++ s++++g a+ra+g+v  +++  v+e+l+d++ 
  evm_27.model.AmTr_v1.0_scaffold00056.60 161 IAEETLAEFLSKATGTAVEWIQMPGMKPGPDSIGIVAISHGCTGVAARACGLVGLEPT-KVSEILKDRPT 229
                                              7899******************************************************.8999999999* PP

                                              T-TT-SEEEEEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--. CS
                                    START  72 Wdetlakaetlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe 138
                                              W ++++++e+l ++s+g  g+++l +++++a+++l++ Rdf+ +Ry+  l++g++v++++S++++q  p+
  evm_27.model.AmTr_v1.0_scaffold00056.60 230 WFRDCRSVEVLTALSTGngGTIELLYMQMYAPTTLASaRDFWLLRYTSVLEDGSLVVCERSLSNTQGGPS 299
                                              ******************************************************************9998 PP

                                              ...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                                    START 139 ...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                                                  +++vRae++pSg+li+p+++g+s ++ v+h+dl+ ++++++lr+l++s+++ ++k+++a+l+++++
  evm_27.model.AmTr_v1.0_scaffold00056.60 300 mppVQQFVRAEMHPSGYLIRPCEGGGSIIHLVDHMDLEPWSVPEVLRPLYESSTVLAQKMTMAALRHLRQ 369
                                              888899***********************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.5481276IPR001356Homeobox domain
SMARTSM003892.4E-161480IPR001356Homeobox domain
CDDcd000866.68E-171577No hitNo description
SuperFamilySSF466892.91E-171580IPR009057Homeodomain-like
PfamPF000462.4E-161775IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-181975IPR009057Homeodomain-like
CDDcd146861.15E-669108No hitNo description
PROSITE profilePS5084826.76151379IPR002913START domain
CDDcd088751.16E-80155371No hitNo description
Gene3DG3DSA:3.30.530.209.2E-26160366IPR023393START-like domain
SuperFamilySSF559613.16E-40160372No hitNo description
SMARTSM002341.8E-41160370IPR002913START domain
PfamPF018524.6E-52161369IPR002913START domain
SuperFamilySSF559613.96E-5397494No hitNo description
SuperFamilySSF559613.96E-5521601No hitNo description
PfamPF086701.1E-52698840IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010014Biological Processmeristem initiation
GO:0010075Biological Processregulation of meristem growth
GO:0010087Biological Processphloem or xylem histogenesis
GO:0048263Biological Processdetermination of dorsal identity
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MAVTACKEGK PGMDPGKYVR YTPEQVEALE RLYHECPKPS SIRRQQLIRE CPILSNIEPK  60
QIKVWFQNRR CREKQRKEAS RLQAVNRKLT AMNKLLMEEN DRLQKQVSQL VYENGYFRQQ  120
TQNVAITTTD TSCESVVTSG QHHLTPQHPP RDASPAGLLS IAEETLAEFL SKATGTAVEW  180
IQMPGMKPGP DSIGIVAISH GCTGVAARAC GLVGLEPTKV SEILKDRPTW FRDCRSVEVL  240
TALSTGNGGT IELLYMQMYA PTTLASARDF WLLRYTSVLE DGSLVVCERS LSNTQGGPSM  300
PPVQQFVRAE MHPSGYLIRP CEGGGSIIHL VDHMDLEPWS VPEVLRPLYE SSTVLAQKMT  360
MAALRHLRQI AQEVSQNTVV GWGRQPAALR ALSQRLSKGF NEALNGFTDD GWSLLGNDGM  420
DDVTILVNSS PAKIMAANLT STNGFPTVCG AVLCAKASML LQNVPPALLI RFLREHRSEW  480
ADSNIDAYSA AALKSNPGTL PTSRMGGFGG QVILPLAHTV EHEEFLEVIK LENHGLVQDD  540
SIIPRDMFLL QLCSGVDENA VGACAELVFA PIDPSFADDA PLLPSGFRII PLDNGVDGSS  600
PNRTLDLASA LEVGPAGNRI SGEFAGGSGS LRSVLTIAFQ FSYENNHEQI RDNVATMARQ  660
YVRSVISSVQ RVAMALTPSR LNPHNGLRPP PGTPEALTLA RWICHSYRFH LGVELLRPNG  720
EGGESLLKML WHHADAIMCC SLKALPVFTF ANQAGLDMLE TTLVALQDIT LEKIFDENGR  780
KTLCADFAQI MQQGFAYLQG GLCVSSMGRP VSYERAVAWK VLNEEESTHC ICFMFMNWSF  840
V*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00200DAPTransfer from AT1G52150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006853643.20.0PREDICTED: homeobox-leucine zipper protein ATHB-15
SwissprotQ9ZU110.0ATB15_ARATH; Homeobox-leucine zipper protein ATHB-15
TrEMBLU5CYT10.0U5CYT1_AMBTC; Uncharacterized protein
STRINGVIT_09s0002g03740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6511671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]